Use and Care Manual
49-2001026 Rev. 1 21
Cleaning the Oven Door
Cleaning the Door Interior
Donotallowexcesswatertorunintoanyholesorslots
in the door .
Wipe dish soap over any baked-on spatters on the glass.
Useasinglesidedsafetyrazorbladetocleanitoff.Then
wipe over the glass with a soapy cloth to remove any
residue and dry off.
The area outside the gasket can be cleaned with a soap-
filledplasticscouringpad.Donotruborcleanthedoor
gasket - it has an extremely low resistance to abrasion.
If you notice the gasket becoming worn, frayed or
damaged in any way or if it has become displaced on the
door, you should have it replaced.
Cleaning the Door Exterior
If a stain on the door vent trim is persistent, use a mild
abrasive cleaner and a sponge-scrubber for best results.
Donotusethismethodonanyothersurface.
Stainless Steel Surfaces (on some models)
Donotuseasteelwoolpad;itwillscratchthesurface.
To clean the stainless steel surface, use warm sudsy
water or a stainless steel cleaner or polish. Always
wipe the surface in the direction of the grain. Follow
the cleaner instructions for cleaning the stainless steel
surface.
To inquire about purchasing cleaning products including
stainless steel appliance cleaner or polish, see the
Accessories and Consumer Support sections at the end
of this manual.
Door and Drawer
CARE AND CLEANING: DoorandDrawer/OvenLight
WARNING
SHOCK OR BURN HAZARD:Beforereplacingovenlightbulb,disconnecttheelectricalpowertothe
range at the main fuse or circuit breaker panel. Failure to do so may result in electric shock or burn.
CAUTION
BURN HAZARD: The glass cover and bulb should be removed when cool. Touching hot glass with
bare hands or a damp cloth can cause burns.
Oven Light
Removable Storage Drawer (on some models)
The storage drawer is a good place to store cookware
andbakeware.Donotstoreplasticsorflammable
material in the drawer.
The storage drawer may be removed for cleaning under
the range. Clean the storage drawer with a damp cloth or
sponge. Never use harsh abrasives or scouring pads.
Yourstoragedrawermayhaveplasticslides(shownto
theright)ormetalrails.Followtherespectiveremovaland
replacement instructions for your model’s configuration.
Removing the Storage Drawer:
1. Pull drawer straight out until it stops.
2. Continue to pull the drawer until it is detached from
the oven.
Replacing the Storage Drawer:
1. Rest the left drawer rail around the inner left rail guide
and slide it in slightly.
2. Place the right drawer rail around the inner right rail
guide and slide it in slightly.
2. Slide the drawer all the way in.
Oven Light Replacement
Besuretoletthelightcoverandbulbcoolcompletely.
To remove the cover:
1. Hold a hand under the cover so it doesn’t fall when
released. With fingers of the same hand, firmly push
back the wire cover holder. Lift off the cover.
Donotremoveanyscrewstoremovethecover.
2. Replace bulb with a 40-watt appliance bulb.
To replace the cover:
1. Place it into groove of the light receptacle. Pull wire
forward to the center of the cover until it snaps into place.
2. Connect electrical power to the range.
Wire cover holder